Shopping Cart (Login required)
alstra banner

Biotage® Initiator+ Alstra™ Microwave Peptide Synthesizer used in Epilepsy Research

27 February 2015

A multi-institutional interdisciplinary research collaboration have recently published their findings where a Biotage® Initiator+ Alstra™ peptide synthesizer was used in a study investigating the role of the galanin neuropeptide in regulation of epileptic seizures in humans.

 

TLE (temporal lobe epilepsy) is a common epilepsy syndrome with a complex etiology. Despite evidence for the participation of genetic factors, the genetic basis of TLE remains largely unknown.

This study identified a mutation in the galanin-encoding gene (GAL) which suggests that a mutation in GAL could impair galanin signaling in the hippocampus, leading to increased glutamatergic excitation and ultimately to temporal lobe epilepsy (TLE). This supports GAL as the causal gene for the temporal lobe epilepsy in the studied family.

A part of the study involved the synthesis of the 30 amino acid galanin peptides, hGal(WT) and hGal(A39E), which were used in galanin receptor binding assays. The results of this study further strengthen the role of galanin in epilepsy and could potentially have direct implications for the development of anti-epileptic treatments.

   [hGal(WT)]: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
[hGal(A39E)]: GWTLNSEGYLLGPHAVGNHRSFSDKNGLTS
Figure 1. Galanin peptides synthesized.

Read More

Guipponi, Michel, et al. "Galanin pathogenic mutations in temporal lobe epilepsy." Human Molecular Genetics (2015): ddv060.

Related Documents

Biotage® Initiator+ Alstra Automated Microwave Peptide Synthesizer

Part No: TNAlstra2012 Published: 2012 0.55 MB Format: pdf Order hardcopy

Featured Videos

Biotage® Initiator+ Alstra™ Peptide Synthesizer