
Biotage® Initiator+ Alstra™ » Biotage® Initiator+ SP Wave » Biotage® Extrahera™ »
This application note describes optimization for a fully automated synthesis and on-resin cyclization of oxytocin enabled by Branches™, a unique software feature of the Biotage® Initiator+ Alstra™ peptide synthesizer.
Tags:
Application Notes
This work demonstrates that peptide purification efficiency by flash
chromatography is improved with Biotage® SNAP Bio cartridges containing a
spherical wide pore stationary under a wide variety of purification conditions.
Tags:
Application Notes
Improved separation Performance with Biotage® SNAP Bio
wide pore Media cartridges
Tags:
Application Notes
Improved Separation Performance Using Biotage®SNAP Bio
Wide Pore media Cartridges – Part 1
Tags:
Application Notes
This application note demonstrates high yield and recovery of the amphipathic peptide ‘18A’ (Ac-18A-NH2) synthesized in a single 30 mL reactor vial.
Tags:
Application Notes
To demonstrate the cost savings by employing small μmol scale automated solid phase peptide synthesis through robot liquid handling of reagents with accurate dispensing of small volumes, a 10-mer antimicrobial peptide was synthesized.
Tags:
Application Notes
A branched peptidoglycan mimic and a tetra-branched antimicrobial peptide analogue were synthesized on a lysine scaffold using Biotage® Initiator+ Alstra™ microwave peptide synthesizer. These peptide modifications are challenging to synthesize and automate, however, the procedure was operationally simplified using Branches™.
Tags:
Application Notes
Synthesis of branched peptides is very challenging. Here we show the synthesis of a complex multi-branched peptide and how this process can be simplified using Branches™.
Tags:
Application Notes
We demonstrate the capability of the Biotage® Initiator+ Alstra™ microwave peptide synthesizer to fully automate the on-resin synthesis of cyclic peptides with examples showing disulfide bridge formation and side-chain to side-chain cyclization respectively.
Tags:
Application Notes
The human β-amyloid (1-42), H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-NH2 (1), sequence is a wellknown difficult sequence to synthesize.1,2 This is due to its
high hydrophobicity at the C-terminus and on-resin aggregation. The peptide is known to be one of the main constituents in amyloid plaques in the brain of Alzheimer’s patients.
Synthetic amyloid peptides are essential research tools to study the molecular mechanisms of neurodegenerative diseases, however, their solid-phase assembly is non-trivial.
Tags:
Application Notes
The ability to synthesize peptides in a range of different
scales is a requirement in many research laboratories. The
Biotage® Initiator+ Alstra™ fully automated microwave peptide
synthesizer has a scale range of 5 μmol up to 2 mmol using
three different reactor vial sizes (5 mL, 10 mL and 30 mL).
The acyl carrier protein fragment, ACP (65–74), H-Val-Gln-
Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-NH2 (VQAAIDYING-NH2) (1), is
a well-known so-called difficult sequence and is commonly
used to evaluate the performance of new synthesis reagents
and instrumentation.
Here we demonstrate a variable scale synthesis on the
Initiator+ Alstra using the ACP (65–74) fragment as a model
peptide.
Tags:
Application Notes
Biotage has developed a range
of tools to improve the peptide synthesis workflow,
from synthesis of crude peptides through to the final
purified product. These solutions make your workflow
more efficient and improve the quality of peptides
you synthesize. Our workflow solutions are used in
pharma, biotech, CRO and academic laboratories
throughout the world.
Tags:
Brochures
On Aug 30, 2017 a scientific literature search for the keywords Biotage AND peptide
was performed by Biotage personnel. The search identified 5380 peer-reviewed
publications from the global community, excluding patents and simple citations.
Below are approximately 100 titles illustrating the breadth and depth of research in
which Biotage tools are utilized.
Tags:
Customer Cases
Dr. Andrew Jamieson leads a team of peptide chemists at the University of Glasgow, where
they synthesize complex molecules for chemical biology applications. An important tool that
contributes to their success has been Biotage® Initiator+ Alstra™ microwave peptide synthesizer,
and they are even breaking the dogma that only HPLC can be used for peptide purification, by
using cutting edge reversed phase flash purification techniques provided by Biotage.
Tags:
Customer Cases
User Case: Professor Roger Strömberg, Karolinska Institutet. One of Professor Strömberg’s projects at Karolinska Institutet
involves the synthesis of artificial nucleases and PNAzymes. In
2013, his research group acquired a Biotage® Initiator+ Alstra™
peptide synthesizer for making PNAs and peptides.
Tags:
Customer Cases
Tokyo based PeptiDream Inc. is a company specializing in non-standard peptide therapeutics containing non-standard amino acids, and conducts research and development of new drug candidates. PeptiDream uses the peptide synthesizers Syro I and Biotage® Initiator+ Alstra™ for the synthesis of various kinds of peptides to support drug discovery and development.
Tags:
Customer Cases
Initiator+ Alstra Testimonial Dr Longhi
Tags:
Customer Cases,
English
Leu-Enkephalin-amide (YGGFLNH2, Ca. MW = 554.65) was synthesized on the Rink amide ChemMatrix® resin at a scale of 0.5 mmol. Crude peptide (100 mg) was purified in duplicate using the Isolera Dalton equipped with a Biotage® SNAP KP-C18-HS 12g cartridge.
Tags:
Customer Cases,
English
Producing peptides for research is challenging. Biotage has developed
a holistic approach to the entire peptide workflow via an automated solution, designed for dedicated peptide researchers and those new to the field.
Tags:
Manuals & User Guides,
Product Notes,
White Papers
Translated versions of the Safety chapter available in the Biotage® Initiator+ Installation and Safety document (P/N 355976). Languages: Danish, Dutch, Finnish, French, German, Italian, Japanese, Spanish, and Swedish.
Tags:
Danish,
Dutch,
Finnish,
French,
German,
Italian,
Japanese,
Manuals & User Guides,
Spanish,
Swedish
Biotage® Initiator Installation and Safety
Tags:
English,
Manuals & User Guides
Quick Start, UV Monitoring, Hints and Tips, Instrument Overview, Software Overview, Switch Between Peptide and Organic Synthesis, Maintenance, General Information.
Tags:
English,
Manuals & User Guides
During the PM visit, the system is given a thorough strip down, service, re-assembly and performance/function test to help ensure that it will remain in good working order for the following year.
Tags:
Manuals & User Guides
Instructions on how to upgrade to Biotage® Initiator+ Alstra™ Software. Failure to follow these instructions may result in loss of data.
Tags:
English,
Manuals & User Guides
Information on how to navigate in the software and hints and tips on how to prepare reagents for peptide synthesis and circumvent side reactions.
Tags:
English,
Manuals & User Guides
Recently there has been substantial motivation to consider and evaluate alternative, more environmentally friendly solvents. Some countries have even gone so far as to ban some of the more toxic, yet commonly used solvents. In addition to general toxicity, the volume of solvent used in any particular application is given extra consideration in the green chemistry movement. In this regard, purification solvent selection is closely monitored as they are often
used in large quantities.
Tags:
English,
Environmental,
Posters
Peptide purification using standard reversed phase HPLC methods are hampered by low loading capacity, resulting in purifications that demand significant time investment. Recently, the use of reversed phase flash chromatography has increased in popularity for peptide purification due to the significant reduction of purification time,
enabled by the increased loading levels of the larger stationary phase particles. Resolution, though, is somewhat diminished with the larger particle size, demanding creative techniques to retain a highly pure peptide product.
Tags:
Posters
We have demonstrated the capability of the Biotage® Initiator+ Alstra
microwave peptide synthesizer to fully synthesize branched and cyclic
peptides. The synthesis included specialized reactions of non-linear peptides and a high degree of purity was achieved. Furthermore, the Branches software feature provides an extensive overview for the scheduling and visualization of operations in order to make complex peptide modifications and is a great addition to the toolbox for the peptide chemist. Presented at EPS, Sofia, 2014.
Tags:
Posters
This poster presents the synthesis of peptidoglycan fragments where the coupling of peptides and carbohydrates was achieved using microwave heating. The fully automated total synthesis of a complex branched peptide is also presented. The fragments were synthesized using Biotage® Initiator+ SP Wave, Biotage® Syro Wave™ and Biotage® Initiator+ Alstra™ respectively. Presented at EPS, Sofia, 2014.
Tags:
Posters
Introduction
• Solid-Phase Peptide Synthesis (SPPS) is still often
faced with difficulties in the assembly of long and
‘difficult’ sequences, e.g. due to aggregation and
steric hindrance giving rise to incomplete reactions.
These problems have only partly been solved by
new coupling reagents and solid supports.
• Precise microwave heating has emerged as one
new parameter for SPPS, in addition to coupling
reagents, resins, solvents etc.
Tags:
Posters
Producing peptides for research is challenging. Biotage has developed
a holistic approach to the entire peptide workflow via an automated solution, designed for dedicated peptide researchers and those new to the field.
Tags:
Manuals & User Guides,
Product Notes,
White Papers
Biotage® Initiator+ Alstra™ is a fully automated, single channel, programmable microwave peptide
synthesizer for Fmoc-solid phase peptide synthesis. This instrument now comes with the Alstra 1.1
software upgrade that introduces new functionality such as Branches, Preactivation and “Edit on
the fly”, and options for UV monitoring and MAOS (organic synthesis) capability.
Tags:
Product Notes
Microwave irradiation is still the most effective solution for providing a fast, precise and efficient heating method for synthesizing peptides, peptoids, PNA and peptidomimetics with higher purity and yield compared to conventional synthesis methods. The Biotage® Initiator+ Alstra is a fully automated microwave peptide synthesizer with built in flexibility for both small and large scale synthesis.
Tags:
Product Notes
El sistema
Initiator+ Alstra de Biotage es un sintetizador de
péptido de microondas totalmente automatizado
construido con la flexibilidad para procesar síntesis a
pequeña y gran escala.
Tags:
Product Notes,
Spanish
Producing peptides for research is challenging. Biotage has developed
a holistic approach to the entire peptide workflow via an automated solution, designed for dedicated peptide researchers and those new to the field.
Tags:
Manuals & User Guides,
Product Notes,
White Papers
"How can I take a two hour purification using old-school chromatography, and shorten it?" was the question Dr. Aaron Muth at St. John's University in New York asked himself. "By using the Biotage I...
09 November 2018This webinar recording demonstrates strategies to synthesize peptides containing one, two, or three disulfide bonds with regioselective control simplfied by the Initatior+ Alstra™ Branches&tr...
27 September 2018Program Your Synthesis from Anywhere The Alstra™ Remote software provides users the ability to program a complete synthesis on their own computer off-line, including calculation of reagents ...
08 May 2018What is the main goal of a peptide chemist? Elizabeth Denton, Ph.D., explains how Biotage sees the peptide synthesis workflow and how we focus on shortening the process time for scientists. Pept...
20 November 2017Although linear synthesis of protected peptides is generally straightforward, purification of these compounds using traditional reversed phase methods is quite challenging. A poster from ...
13 November 2017The study of peptides, especially for therapeutic use, has grown significantly in recent years. However, producing peptides for such research is challenging, not just in the s...
02 November 2017The purification step is one of the main bottlenecks in the peptide synthesis workflow. Preparative reversed-phase HPLC is normally the method of choice for purification of synthetic peptides, but ...
27 September 2017A quick literature review recently identified 5380 peer-reviewed publications from the global community on peptide synthesis where Biotage equipment has been used. The body of published literature ...
13 July 2017Biotage is pleased to announce the release of the new Peptide Synthesis Workflow – Synthesis, Purification, and Evaporation Solutions Brochure The typical peptide synthesis workflow broadly ...
12 April 2017Biotage has won a long-running patent dispute against competitor CEM. The dispute originates from 2011 when Biotage challenged the validity of claims in two process patents filed by CEM in Europe a...
06 February 2017Dr. Andrew Jamieson leads a team of peptide chemists at the University of Glasgow, where they synthesize complex molecules for chemical biology applications. An important tool that contributes to t...
19 January 2017Biotage® SNAP Bio flash cartridges were developed with a small particle size (20 μm) and large pore size (~300 Å) to provide increased resolution and effective separation of complex pe...
10 January 2017Recent advances in flash purification using 20–25 micron spherical particles makes flash chromatography an efficient technique for synthetic peptide purification. This application note from B...
13 December 2016This webinar discusses some recent work on the use of flash chromatography for the purification of synthetic peptides as a complementary alternative to standard RP-HPLC methods. Included herein are...
05 September 2016Amit Mehrotra, Global Product Manager Peptide Systems at Biotage, covers the modern approach to peptide synthesis in this webinar aired on September 1st 2016. The typical peptide synthesis workflo...
01 September 2016Thursday 1st September 2016 11:00 am Central European Summer Time (10:00 am BST) 1:00 pm US Eastern Time (10:00 am US Pacific Time) Register Here » The typical peptide synthesis wor...
07 March 2016Peptide nucleic acid (PNA) oligomers were synthesized on a Biotage® Initiator+ Alstra™ microwave peptide synthesizer, as demonstrated in this application note from Biotage in collabo...
18 January 2016The use of fast and precise microwave heating in solid phase peptide synthesis can result in peptides of greater purity, thereby simplifying the subsequent purification steps. In this application n...
18 December 2015The fully automated microwave peptide synthesizer Biotage® Initiator+ Alstra™ has the built-in feature, Branches™, which makes programming cyclic and branched peptides easy. ...
02 December 2015Professor Roger Strömberg is Head of the Bioorganic Chemistry Unit at the Department of Biosciences and Nutrition, Karolinska Institutet in Huddinge, Sweden. He leads a number of research proj...
16 November 2015The research group of Prof. Jonel P. Saludes at Washington State University used Biotage® Initiator+ SP Wave and Biotage® Initiator+ Alstra™ synthesizers in developing cell penetratin...
09 November 2015Tokyo based PeptiDream Inc. is a company specializing in non-standard peptide therapeutics containing non-standard amino acids, and conducts research and development of new drug candidates. PeptiDr...
03 November 2015This application note highlights the excellent quality of synthesis that was achieved using the Biotage® Initiator+ Alstra™ microwave peptide synthesizer and after purification by RP-HPLC...
20 May 2015A research group from Kyoto University have recently published a method for the chemical synthesis of La1, a 73 amino acid cysteine-rich peptide from scorpion venom. La1 is a 73-residue pe...
20 April 2015Biotage will attend the 2nd Annual Peptide Conference 20-21 April, 2015Novotel London West, London, UK Read More http://www.peptides-congress.co
27 February 2015A multi-institutional interdisciplinary research collaboration have recently published their findings where a Biotage® Initiator+ Alstra™ peptide synthesizer was used in a study investiga...
02 January 2015This application note illustrates the small µmol scale synthesis of a labeled antimicrobial peptide on Biotage® Initiator+ Alstra™. The ability to easily perform peptide sy...
29 December 2014Branched peptides are of great interest due to their therapeutic potential and many interesting peptides have a branched structure such as multiple antigenic peptides (MAP) and peptidoglycans....
10 November 2014A new application note illustrates the synthesis of a complex multi-branched peptide by means of a clean and simple user interface called Branches™, unique to Biotage. There is growi...
17 October 2014A new application note illustrates the synthesis of two cyclic peptides using Branches™ There is growing interest in naturally occurring and designed bioactive cyclic peptides. These...
07 October 2014Two recent peptide posters presented at the European Peptide Symposium 2014 in Sofia, Bulgaria, are now available for download. The research was carried out in the group of Professor Knud J. Jensen...
17 September 2014Relevant peptide associations. Please contact webmaster to add to, or update this page. Asia Pacific Protein Association Association of Biomolecular Resource Facilities American Peptide Societ...
31 August 2014Biotage is attending EPS 2014 31st August - 5th September 2014, Sofia, Bulgaria Read more at the conference website http://www.33eps2014.com/pages/info-about-bulgaria
02 July 2014A short video demonstrating the capabilities of Biotage® Initiator+ Alstra™, a fully automated microwave peptide synthesizer, is released today on the biotage.com website. The video gives...
01 April 2014Biotage is attending Analytica1-4 April 2014, Munich, Germany Introducing the latest addition to the Biotage family of sample preparation instruments! It's all happening in Hall A1 on Booth 221&n...
25 February 2014To upgrade your Initiator+ Alstra™ to the latest 1.2.2. release, please contact Biotage® 1-Point-Support™ and provide them with the following information: Name Email address Ad...
22 February 2014Gordon Research Conference (GRC) February 22-23, 2014Ventura Beach MarriottVentura, CA Read more >
21 January 2014Biotage has released a new application note for Isolera™ Dalton mass directed flash purification. Synopsis: We demonstrate the mass-directed purification of a simple peptide usin...
27 November 2013Peptide Synthesis, Purification, Mass Identification and Evaporation using the full range of Biotage instruments and consumables. Biotage® Initiator+ Alstra™ is a fully automated microwa...
08 September 2013Biotage is attending the 10th Australian Peptide Conference 8th–13th September 2013, Shangri-La Golden Sands Resort, Penang, Malaysia Read more at conference website >
12 July 2013The Peptide Webinar held on July 3rd by Ph. D. Karolina Wahlström is now available to view on-demand. Click here to view.
13 May 2013Uppsala, Sweden, May 13th, 2013 CEM, a competitor of Biotage, recently published a press release claiming to have won a “patent dispute” with Biotage. The so called “patent ...
03 September 2012Uppsala, Sweden, 3rd September, 2012 Biotage® (STO: BIOT), a leading global supplier of solutions and technology for analytical, medicinal and peptide chemistry, introduced an innovative new s...
01 May 2012For the past decade our customers have been using Biotage's microwave synthesis systems for solid phase synthesis of peptides, peptoids and peptidomimetics. In celebration of this decade of excelle...
31 May 2011Uppsala, Sweden, May 31, 2011 – Biotage (STO: BIOT), a leading supplier of tools and technology for analytical and medicinal chemistry, announced a collaborative research agreement with The L...
30 August 2010Charlotte, NC USA, August 30, 2010 – Biotage (STO: BIOT), a leading supplier of tools and technology for medicinal and analytical chemistry, has launched a new range of HPLC columns optimized...
12 May 2010Biotage Announces Research Collaboration with University of Copenhagen for Peptide Synthesis Uppsala, Sweden, March 23, 2010 – Biotage (STO: BIOT), a leading supplier of tools and technology...
Part No. | Description | Product type | Pack Size | Price | ||
![]() |
356017 | Biotage® Initiator+ Alstra - Microwave Peptide Synthesizer EU | Instruments | 1 | Log in for price | |
![]() |
356018 | Biotage® Initiator+ Alstra - Microwave Peptide Synthesizer US/JP | Instruments | 1 | Log in for price |
Part No. | Description | Product type | Pack Size | Price | ||
![]() |
356385 | Vial collar | Spare parts | 1 | Log in for price |