This application note describes optimization for a fully automated synthesis and on-resin cyclization of oxytocin enabled by Branches™, a unique software feature of the Biotage® Initiator+ Alstra™ peptide synthesizer.
Tags: Application Notes

This work demonstrates that peptide purification efficiency by flash chromatography is improved with Biotage® SNAP Bio cartridges containing a spherical wide pore stationary under a wide variety of purification conditions.
Tags: Application Notes

Improved separation Performance with Biotage® SNAP Bio wide pore Media cartridges
Tags: Application Notes

Improved Separation Performance Using Biotage®SNAP Bio Wide Pore media Cartridges – Part 1
Tags: Application Notes

This application note demonstrates high yield and recovery of the amphipathic peptide ‘18A’ (Ac-18A-NH2) synthesized in a single 30 mL reactor vial.
Tags: Application Notes

To demonstrate the cost savings by employing small μmol scale automated solid phase peptide synthesis through robot liquid handling of reagents with accurate dispensing of small volumes, a 10-mer antimicrobial peptide was synthesized.
Tags: Application Notes

A branched peptidoglycan mimic and a tetra-branched antimicrobial peptide analogue were synthesized on a lysine scaffold using Biotage® Initiator+ Alstra™ microwave peptide synthesizer. These peptide modifications are challenging to synthesize and automate, however, the procedure was operationally simplified using Branches™.
Tags: Application Notes

Synthesis of branched peptides is very challenging. Here we show the synthesis of a complex multi-branched peptide and how this process can be simplified using Branches™.
Tags: Application Notes

We demonstrate the capability of the Biotage® Initiator+ Alstra™ microwave peptide synthesizer to fully automate the on-resin synthesis of cyclic peptides with examples showing disulfide bridge formation and side-chain to side-chain cyclization respectively.
Tags: Application Notes

The human β-amyloid (1-42), H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-NH2 (1), sequence is a wellknown difficult sequence to synthesize.1,2 This is due to its high hydrophobicity at the C-terminus and on-resin aggregation. The peptide is known to be one of the main constituents in amyloid plaques in the brain of Alzheimer’s patients. Synthetic amyloid peptides are essential research tools to study the molecular mechanisms of neurodegenerative diseases, however, their solid-phase assembly is non-trivial.
Tags: Application Notes

The ability to synthesize peptides in a range of different scales is a requirement in many research laboratories. The Biotage® Initiator+ Alstra™ fully automated microwave peptide synthesizer has a scale range of 5 μmol up to 2 mmol using three different reactor vial sizes (5 mL, 10 mL and 30 mL). The acyl carrier protein fragment, ACP (65–74), H-Val-Gln- Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-NH2 (VQAAIDYING-NH2) (1), is a well-known so-called difficult sequence and is commonly used to evaluate the performance of new synthesis reagents and instrumentation. Here we demonstrate a variable scale synthesis on the Initiator+ Alstra using the ACP (65–74) fragment as a model peptide.
Tags: Application Notes

Biotage has developed a range of tools to improve the peptide synthesis workflow, from synthesis of crude peptides through to the final purified product. These solutions make your workflow more efficient and improve the quality of peptides you synthesize. Our workflow solutions are used in pharma, biotech, CRO and academic laboratories throughout the world.
Tags: Brochures

On Aug 30, 2017 a scientific literature search for the keywords Biotage AND peptide was performed by Biotage personnel. The search identified 5380 peer-reviewed publications from the global community, excluding patents and simple citations. Below are approximately 100 titles illustrating the breadth and depth of research in which Biotage tools are utilized.
Tags: Customer Cases

Dr. Andrew Jamieson leads a team of peptide chemists at the University of Glasgow, where they synthesize complex molecules for chemical biology applications. An important tool that contributes to their success has been Biotage® Initiator+ Alstra™ microwave peptide synthesizer, and they are even breaking the dogma that only HPLC can be used for peptide purification, by using cutting edge reversed phase flash purification techniques provided by Biotage.
Tags: Customer Cases

User Case: Professor Roger Strömberg, Karolinska Institutet. One of Professor Strömberg’s projects at Karolinska Institutet involves the synthesis of artificial nucleases and PNAzymes. In 2013, his research group acquired a Biotage® Initiator+ Alstra™ peptide synthesizer for making PNAs and peptides.
Tags: Customer Cases

Tokyo based PeptiDream Inc. is a company specializing in non-standard peptide therapeutics containing non-standard amino acids, and conducts research and development of new drug candidates. PeptiDream uses the peptide synthesizers Syro I and Biotage® Initiator+ Alstra™ for the synthesis of various kinds of peptides to support drug discovery and development.
Tags: Customer Cases

Initiator+ Alstra Testimonial Dr Longhi
Tags: Customer Cases, English

Leu-Enkephalin-amide (YGGFLNH2, Ca. MW = 554.65) was synthesized on the Rink amide ChemMatrix® resin at a scale of 0.5 mmol. Crude peptide (100 mg) was purified in duplicate using the Isolera Dalton equipped with a Biotage® SNAP KP-C18-HS 12g cartridge.
Tags: Customer Cases, English

Producing peptides for research is challenging. Biotage has developed a holistic approach to the entire peptide workflow via an automated solution, designed for dedicated peptide researchers and those new to the field.
Tags: Manuals & User Guides, Product Notes, White Papers

Translated versions of the Safety chapter available in the Biotage® Initiator+ Installation and Safety document (P/N 355976). Languages: Danish, Dutch, Finnish, French, German, Italian, Japanese, Spanish, and Swedish.
Tags: Danish, Dutch, Finnish, French, German, Italian, Japanese, Manuals & User Guides, Spanish, Swedish

Biotage® Initiator Installation and Safety
Tags: English, Manuals & User Guides

Quick Start, UV Monitoring, Hints and Tips, Instrument Overview, Software Overview, Switch Between Peptide and Organic Synthesis, Maintenance, General Information.
Tags: English, Manuals & User Guides

During the PM visit, the system is given a thorough strip down, service, re-assembly and performance/function test to help ensure that it will remain in good working order for the following year.
Tags: Manuals & User Guides

Instructions on how to upgrade to Biotage® Initiator+ Alstra™ Software. Failure to follow these instructions may result in loss of data.
Tags: English, Manuals & User Guides

Tags: English, Manuals & User Guides

Information on how to navigate in the software and hints and tips on how to prepare reagents for peptide synthesis and circumvent side reactions.
Tags: English, Manuals & User Guides

Recently there has been substantial motivation to consider and evaluate alternative, more environmentally friendly solvents. Some countries have even gone so far as to ban some of the more toxic, yet commonly used solvents. In addition to general toxicity, the volume of solvent used in any particular application is given extra consideration in the green chemistry movement. In this regard, purification solvent selection is closely monitored as they are often used in large quantities.
Tags: English, Environmental, Posters

Peptide purification using standard reversed phase HPLC methods are hampered by low loading capacity, resulting in purifications that demand significant time investment. Recently, the use of reversed phase flash chromatography has increased in popularity for peptide purification due to the significant reduction of purification time, enabled by the increased loading levels of the larger stationary phase particles. Resolution, though, is somewhat diminished with the larger particle size, demanding creative techniques to retain a highly pure peptide product.
Tags: Posters

We have demonstrated the capability of the Biotage® Initiator+ Alstra microwave peptide synthesizer to fully synthesize branched and cyclic peptides. The synthesis included specialized reactions of non-linear peptides and a high degree of purity was achieved. Furthermore, the Branches software feature provides an extensive overview for the scheduling and visualization of operations in order to make complex peptide modifications and is a great addition to the toolbox for the peptide chemist. Presented at EPS, Sofia, 2014.
Tags: Posters

This poster presents the synthesis of peptidoglycan fragments where the coupling of peptides and carbohydrates was achieved using microwave heating. The fully automated total synthesis of a complex branched peptide is also presented. The fragments were synthesized using Biotage® Initiator+ SP Wave, Biotage® Syro Wave™ and Biotage® Initiator+ Alstra™ respectively. Presented at EPS, Sofia, 2014.
Tags: Posters

Introduction • Solid-Phase Peptide Synthesis (SPPS) is still often faced with difficulties in the assembly of long and ‘difficult’ sequences, e.g. due to aggregation and steric hindrance giving rise to incomplete reactions. These problems have only partly been solved by new coupling reagents and solid supports. • Precise microwave heating has emerged as one new parameter for SPPS, in addition to coupling reagents, resins, solvents etc.
Tags: Posters

Producing peptides for research is challenging. Biotage has developed a holistic approach to the entire peptide workflow via an automated solution, designed for dedicated peptide researchers and those new to the field.
Tags: Manuals & User Guides, Product Notes, White Papers

Biotage® Initiator+ Alstra™ is a fully automated, single channel, programmable microwave peptide synthesizer for Fmoc-solid phase peptide synthesis. This instrument now comes with the Alstra 1.1 software upgrade that introduces new functionality such as Branches, Preactivation and “Edit on the fly”, and options for UV monitoring and MAOS (organic synthesis) capability.
Tags: Product Notes

Microwave irradiation is still the most effective solution for providing a fast, precise and efficient heating method for synthesizing peptides, peptoids, PNA and peptidomimetics with higher purity and yield compared to conventional synthesis methods. The Biotage® Initiator+ Alstra is a fully automated microwave peptide synthesizer with built in flexibility for both small and large scale synthesis.
Tags: Product Notes

El sistema Initiator+ Alstra de Biotage es un sintetizador de péptido de microondas totalmente automatizado construido con la flexibilidad para procesar síntesis a pequeña y gran escala.
Tags: Product Notes, Spanish

Tags: English, Release Notes

Producing peptides for research is challenging. Biotage has developed a holistic approach to the entire peptide workflow via an automated solution, designed for dedicated peptide researchers and those new to the field.
Tags: Manuals & User Guides, Product Notes, White Papers