Documents|Synthesis of v-amyloid (1-42) Using Microwave Heating on the Biotage® Initiator+ Alstra™
Synthesis of v-amyloid (1-42) Using Microwave Heating on the Biotage® Initiator+ Alstra™
The human v-amyloid (1-42), H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-NH2 (1), sequence is a well known difficult sequence to synthesize.1,2 This is due to its high hydrophobicity at the C-terminus and on-resin aggregation. The peptide is known to be one of the main constituents in amyloid plaques in the brain of Alzheimer's patients. Synthetic amyloid peptides are essential research tools to study the molecular mechanisms of neurodegenerative diseases, however, their solid-phase assembly is non-trivial.
Download Options
DownloadE-mail a CopySynthesis of v-amyloid (1-42) Using Microwave Heating on the Biotage® Initiator+ Alstra™